CTLA4_HUMAN P16410
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16410
Recommended name：Cytotoxic T-lymphocyte protein 4
EC number：
Alternative names：(Cytotoxic T-lymphocyte-associated antigen 4) (CTLA-4) (CD antigen CD152)
Cleaved into：
GeneID：1493
Gene names (primary )：CTLA4
Gene names (synonym )：CD152
Gene names (ORF )：
Length：223
Mass：24656
Sequence：MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Tissue specificity：Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation. {ECO:0000269|PubMed:10493833, ECO:0000269|PubMed:16551244, ECO:0000269|PubMed:1713603}.
Induction：
Developmental stage：
Protein families：