CPIN1_HUMAN Q6FI81
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6FI81
Recommended name：Anamorsin
EC number：
Alternative names：(Cytokine-induced apoptosis inhibitor 1) (Fe-S cluster assembly protein DRE2 homolog)
Cleaved into：
GeneID：57019
Gene names (primary )：CIAPIN1
Gene names (synonym )：
Gene names (ORF )：CUA001 PRO0915
Length：312
Mass：33582
Sequence：MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Tissue specificity：Ubiquitously expressed. Highly expressed in heart, liver and pancreas. {ECO:0000269|PubMed:14970183}.
Induction：
Developmental stage：
Protein families：Anamorsin family