C2G1P_HUMAN   Q6ZSU1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6ZSU1

Recommended name:Putative inactive cytochrome P450 2G1

EC number:

Alternative names:(Cytochrome P450 2G1 pseudogene)

Cleaved into:

GeneID:

Gene names  (primary ):CYP2G1P

Gene names  (synonym ):CYP2GP1

Gene names  (ORF ):

Length:146

Mass:16683

Sequence:MPYTDVVIHEIQRLVDIVPMGVPHNIIQDTQFRGYLLPKGTDVFPLLGSVLKDPKYFRYPDAFYPQHFLDEQGRFKKNEAFVPFSSGKRICLGEAMARMELFLYFTSTLQNFSLCSLVPLVDIDITPKLSGFGNITPTYELCLVAR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome P450 family


   💬 WhatsApp