COX8A_HUMAN   P10176


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P10176

Recommended name:Cytochrome c oxidase subunit 8A, mitochondrial

EC number:

Alternative names:(Cytochrome c oxidase polypeptide VIII-liver/heart) (Cytochrome c oxidase subunit 8-2)

Cleaved into:

GeneID:1351

Gene names  (primary ):COX8A

Gene names  (synonym ):COX8 COX8L

Gene names  (ORF ):

Length:69

Mass:7579

Sequence:MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome c oxidase VIII family


   💬 WhatsApp