CYB5B_HUMAN   O43169


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43169

Recommended name:Cytochrome b5 type B

EC number:

Alternative names:(Cytochrome b5 outer mitochondrial membrane isoform)

Cleaved into:

GeneID:80777

Gene names  (primary ):CYB5B

Gene names  (synonym ):CYB5M OMB5

Gene names  (ORF ):

Length:150

Mass:16695

Sequence:MSGSMATAEASGSDGKGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Cytochrome b5 family


   💬 WhatsApp