CLC3A_HUMAN   O75596


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75596

Recommended name:C-type lectin domain family 3 member A

EC number:

Alternative names:(C-type lectin superfamily member 1) (Cartilage-derived C-type lectin)

Cleaved into:

GeneID:10143

Gene names  (primary ):CLEC3A

Gene names  (synonym ):CLECSF1

Gene names  (ORF ):UNQ700/PRO1345

Length:197

Mass:22233

Sequence:MAKNGLVICILVITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKKCYLASEGLKHFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVDVNGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTIPQ

Tissue specificity:Restricted to cartilage and breast. Also expressed in breast cancers. {ECO:0000269|PubMed:19173304}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp