CT62_HUMAN   P0C5K7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C5K7

Recommended name:Cancer/testis antigen 62

EC number:

Alternative names:(CT62)

Cleaved into:

GeneID:196993

Gene names  (primary ):CT62

Gene names  (synonym ):

Gene names  (ORF ):

Length:136

Mass:15412

Sequence:MMHTTSYRRLSPPHLTDQPSAYSHTHRTFSHFSCGSQPAAQRLHVELWNADLQSEFLCPCLGLTLYLTCNPQLGKRKFCSHSSEDMSKMVSRRNVKDSHEVSGSLQATLQVISFSFPFLLHTCSHPLSHPTSGQRR

Tissue specificity:Testis specific. Expressed in cancer cell lines. {ECO:0000269|PubMed:15905330}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp