DPH3_HUMAN   Q96FX2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96FX2

Recommended name:DPH3 homolog

EC number:

Alternative names:(CSL-type zinc finger-containing protein 2) (DelGEF-interacting protein 1) (DelGIP1)

Cleaved into:

GeneID:285381

Gene names  (primary ):DPH3

Gene names  (synonym ):DESR1 ZCSL2

Gene names  (ORF ):

Length:82

Mass:9240

Sequence:MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKC

Tissue specificity:Widely expressed with highest levels in small intestine, spleen, thymus, heart, liver and lung. {ECO:0000269|PubMed:14527407, ECO:0000269|PubMed:14980502}.

Induction:

Developmental stage:

Protein families:DPH3 family


   💬 WhatsApp