DPH3_HUMAN Q96FX2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96FX2
Recommended name：DPH3 homolog
EC number：
Alternative names：(CSL-type zinc finger-containing protein 2) (DelGEF-interacting protein 1) (DelGIP1)
Cleaved into：
GeneID：285381
Gene names (primary )：DPH3
Gene names (synonym )：DESR1 ZCSL2
Gene names (ORF )：
Length：82
Mass：9240
Sequence：MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELVKC
Tissue specificity：Widely expressed with highest levels in small intestine, spleen, thymus, heart, liver and lung. {ECO:0000269|PubMed:14527407, ECO:0000269|PubMed:14980502}.
Induction：
Developmental stage：
Protein families：DPH3 family