CSKMT_HUMAN   A8MUP2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A8MUP2

Recommended name:Citrate synthase-lysine N-methyltransferase CSKMT, mitochondrial

EC number:EC:2.1.1.-

Alternative names:(CS-KMT) (Methyltransferase-like protein 12, mitochondrial)

Cleaved into:

GeneID:751071

Gene names  (primary ):CSKMT

Gene names  (synonym ):METTL12

Gene names  (ORF ):

Length:240

Mass:25910

Sequence:MAALRRMLHLPSLMMGTCRPFAGSLADSCLADRCLWDRLHAQPRLGTVPTFDWFFGYDEVQGLLLPLLQEAQAASPLRVLDVGCGTSSLCTGLYTKSPHPVDVLGVDFSPVAVAHMNSLLEGGPGQTPLCPGHPASSLHFMHADAQNLGAVASSGSFQLLLDKGTWDAVARGGLPRAYQLLSECLRVLNPQGTLIQFSDEDPDVRLPCLEQGSYGWTVTVQELGPFRGITYFAYLIQGSH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Methyltransferase superfamily


   💬 WhatsApp