CRIP2_HUMAN   P52943


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52943

Recommended name:Cysteine-rich protein 2

EC number:

Alternative names:(CRP-2) (Protein ESP1)

Cleaved into:

GeneID:1397

Gene names  (primary ):CRIP2

Gene names  (synonym ):CRP2

Gene names  (ORF ):

Length:208

Mass:22493

Sequence:MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

Tissue specificity:Widespread tissue expression; highest levels in the heart.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp