CXA4_HUMAN   P35212


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35212

Recommended name:Gap junction alpha-4 protein

EC number:

Alternative names:(Connexin-37) (Cx37)

Cleaved into:

GeneID:2701

Gene names  (primary ):GJA4

Gene names  (synonym ):

Gene names  (ORF ):

Length:333

Mass:37414

Sequence:MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV

Tissue specificity:Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium.

Induction:

Developmental stage:

Protein families:Connexin family, Alpha-type (group II) subfamily


   💬 WhatsApp