CXG3_HUMAN Q8NFK1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8NFK1
Recommended name：Gap junction gamma-3 protein
EC number：
Alternative names：(Connexin-30.2) (Cx30.2) (Connexin-31.3) (Cx31.3) (Gap junction epsilon-1 protein)
Cleaved into：
GeneID：349149
Gene names (primary )：GJC3
Gene names (synonym )：GJE1
Gene names (ORF )：
Length：279
Mass：31299
Sequence：MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGCKAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGREGNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITCNLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRRHKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
Tissue specificity：CNS specific. Expression is restricted to brain, spinal cord, and sciatic nerve. According to PubMed:12881038, expression is abundant in skeletal muscle, liver, and heart, and to a minor degree in pancreas and kidney. {ECO:0000269|PubMed:12151525, ECO:0000269|PubMed:12881038}.
Induction：
Developmental stage：
Protein families：Connexin family, Gamma-type subfamily