NDUB5_HUMAN   O43674


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O43674

Recommended name:NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

EC number:

Alternative names:(Complex I-SGDH) (CI-SGDH) (NADH-ubiquinone oxidoreductase SGDH subunit)

Cleaved into:

GeneID:4711

Gene names  (primary ):NDUFB5

Gene names  (synonym ):

Gene names  (ORF ):

Length:189

Mass:21750

Sequence:MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFB5 subunit family


   💬 WhatsApp