NDUA1_HUMAN O15239
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O15239
Recommended name：NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
EC number：
Alternative names：(Complex I-MWFE) (CI-MWFE) (NADH-ubiquinone oxidoreductase MWFE subunit)
Cleaved into：
GeneID：4694
Gene names (primary )：NDUFA1
Gene names (synonym )：
Gene names (ORF )：
Length：70
Mass：8072
Sequence：MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID
Tissue specificity：Primarily expressed in heart and skeletal muscle.
Induction：
Developmental stage：
Protein families：Complex I NDUFA1 subunit family