QCR10_HUMAN O14957
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14957
Recommended name：Cytochrome b-c1 complex subunit 10
EC number：
Alternative names：(Complex III subunit 10) (Complex III subunit XI) (Ubiquinol-cytochrome c reductase complex 6.4 kDa protein)
Cleaved into：
GeneID：10975
Gene names (primary )：UQCR11
Gene names (synonym )：UQCR
Gene names (ORF )：
Length：56
Mass：6570
Sequence：MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
Tissue specificity：
Induction：
Developmental stage：
Protein families：UQCR11/QCR10 family