NDUBB_HUMAN   Q9NX14


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NX14

Recommended name:NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial

EC number:

Alternative names:(Complex I-ESSS) (CI-ESSS) (NADH-ubiquinone oxidoreductase ESSS subunit) (Neuronal protein 17.3) (Np17.3) (p17.3)

Cleaved into:

GeneID:54539

Gene names  (primary ):NDUFB11

Gene names  (synonym ):

Gene names  (ORF ):UNQ111/PRO1064

Length:153

Mass:17317

Sequence:MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE

Tissue specificity:Ubiquitous.

Induction:

Developmental stage:

Protein families:Complex I NDUFB11 subunit family


   💬 WhatsApp