NDUAB_HUMAN   Q86Y39


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86Y39

Recommended name:NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11

EC number:

Alternative names:(Complex I-B14.7) (CI-B14.7) (NADH-ubiquinone oxidoreductase subunit B14.7)

Cleaved into:

GeneID:126328

Gene names  (primary ):NDUFA11

Gene names  (synonym ):

Gene names  (ORF ):

Length:141

Mass:14852

Sequence:MAPKVFRQYWDIPDGTDCHRKAYSTTSIASVAGLTAAAYRVTLNPPGTFLEGVAKVGQYTFTAAAVGAVFGLTTCISAHVREKPDDPLNYFLGGCAGGLTLGARTHNYGIGAAACVYFGIAASLVKMGRLEGWEVFAKPKV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFA11 subunit family


   💬 WhatsApp