NDUS6_HUMAN   O75380


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75380

Recommended name:NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

EC number:

Alternative names:(Complex I-13kD-A) (CI-13kD-A) (NADH-ubiquinone oxidoreductase 13 kDa-A subunit)

Cleaved into:

GeneID:4726

Gene names  (primary ):NDUFS6

Gene names  (synonym ):

Gene names  (ORF ):

Length:124

Mass:13712

Sequence:MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQKEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHHH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Complex I NDUFS6 subunit family


   💬 WhatsApp