C1T9A_HUMAN P0C862
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C862
Recommended name：Complement C1q and tumor necrosis factor-related protein 9A
EC number：
Alternative names：(Complement C1q and tumor necrosis factor-related protein 9)
Cleaved into：
GeneID：338872
Gene names (primary )：C1QTNF9
Gene names (synonym )：C1QTNF9A
Gene names (ORF )：UNQ6503/PRO21380
Length：333
Mass：34681
Sequence：MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGRPGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
Tissue specificity：Expressed predominantly in adipose tissue. {ECO:0000269|PubMed:19666007}.
Induction：
Developmental stage：
Protein families：