MIA40_HUMAN Q8N4Q1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N4Q1
Recommended name：Mitochondrial intermembrane space import and assembly protein 40
EC number：
Alternative names：(Coiled-coil-helix-coiled-coil-helix domain-containing protein 4)
Cleaved into：
GeneID：131474
Gene names (primary )：CHCHD4
Gene names (synonym )：MIA40
Gene names (ORF )：
Length：142
Mass：15996
Sequence：MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
Tissue specificity：Expressed in all tissues tested, suggesting an ubiquitous expression. {ECO:0000269|PubMed:16185709}.
Induction：
Developmental stage：
Protein families：