CC163_HUMAN   A0A0D9SF12


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0A0D9SF12

Recommended name:Transmembrane protein CCDC163

EC number:

Alternative names:(Coiled-coil domain-containing protein 163) (coiled-coil domain containing 163 pseudogene)

Cleaved into:

GeneID:

Gene names  (primary ):CCDC163

Gene names  (synonym ):C1orf231 CCDC163P

Gene names  (ORF ):

Length:145

Mass:16203

Sequence:MNTSLSWFEQLDVLLNATDGNVVRNKQWLYPLGVSTELIGLCICFFCSSGCIFLGSPPQNSTAVTPAVLWEESEIMQKELKLLQYQLSQHQELLLKQLAEGRQAQVGSWKIPRGAPFLTWSPASFSSMPRVLSKRTYSFGAPKCS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp