COQ4_HUMAN   Q9Y3A0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y3A0

Recommended name:Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial

EC number:

Alternative names:(Coenzyme Q biosynthesis protein 4 homolog)

Cleaved into:

GeneID:51117

Gene names  (primary ):COQ4

Gene names  (synonym ):

Gene names  (ORF ):CGI-92

Length:265

Mass:29657

Sequence:MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKGLLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA

Tissue specificity:Expressed ubiquitously, but at high levels in liver, lung and pancreas. {ECO:0000269|PubMed:18474229}.

Induction:

Developmental stage:

Protein families:COQ4 family


   💬 WhatsApp