CNIH2_HUMAN   Q6PI25


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6PI25

Recommended name:Protein cornichon homolog 2

EC number:

Alternative names:(CNIH-2) (Cornichon family AMPA receptor auxiliary protein 2) (Cornichon-like protein)

Cleaved into:

GeneID:254263

Gene names  (primary ):CNIH2

Gene names  (synonym ):CNIL

Gene names  (ORF ):

Length:160

Mass:18931

Sequence:MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF

Tissue specificity:Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study). {ECO:0000269|PubMed:23103966}.

Induction:

Developmental stage:

Protein families:Cornichon family


   💬 WhatsApp