CNIH1_HUMAN O95406
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95406
Recommended name：Protein cornichon homolog 1
EC number：
Alternative names：(CNIH-1) (Cornichon family AMPA receptor auxiliary protein 1) (Protein cornichon homolog) (T-cell growth-associated molecule 77) (TGAM77)
Cleaved into：
GeneID：10175
Gene names (primary )：CNIH1
Gene names (synonym )：CNIH CNIL
Gene names (ORF )：UNQ155/PRO181
Length：144
Mass：16699
Sequence：MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
Tissue specificity：Highly expressed in heart, liver, skeletal muscle, pancreas, adrenal medulla and cortex, thyroid, testis, spleen, appendix, peripheral blood lymphocytes and bone marrow. Lower expression found in brain, placenta, lung, kidney, ovary, small intestine, stomach, lymph node, thymus and fetal liver. Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study). {ECO:0000269|PubMed:23103966}.
Induction：
Developmental stage：
Protein families：Cornichon family