CLM7_HUMAN   A8K4G0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A8K4G0

Recommended name:CMRF35-like molecule 7

EC number:

Alternative names:(CLM-7) (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5) (CD antigen CD300b)

Cleaved into:

GeneID:124599

Gene names  (primary ):CD300LB

Gene names  (synonym ):CD300B CLM7 CMRF35A2 IREM3 LMIR5 TREM5

Gene names  (ORF ):UNQ2530/PRO6029

Length:201

Mass:22689

Sequence:MWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT

Tissue specificity:Expressed exclusively in myeloid lineages. {ECO:0000269|PubMed:16920917}.

Induction:

Developmental stage:

Protein families:CD300 family


   💬 WhatsApp