HES2_HUMAN Q9Y543
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Y543
Recommended name:Transcription factor HES-2
EC number:
Alternative names:(Class B basic helix-loop-helix protein 40) (bHLHb40) (Hairy and enhancer of split 2)
Cleaved into:
GeneID:54626
Gene names (primary ):HES2
Gene names (synonym ):BHLHB40
Gene names (ORF ):
Length:173
Mass:18470
Sequence:MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLWRRAASATLDGGRAGDSSGPSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW
Tissue specificity:Expressed in placenta, pancreatic cancer, colon cancer with RER, cervical cancer, and in head and neck tumors. {ECO:0000269|PubMed:15254753}.
Induction:
Developmental stage:
Protein families: