SPRY7_HUMAN   Q5W111


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5W111

Recommended name:SPRY domain-containing protein 7

EC number:

Alternative names:(Chronic lymphocytic leukemia deletion region gene 6 protein) (CLL deletion region gene 6 protein)

Cleaved into:

GeneID:57213

Gene names  (primary ):SPRYD7

Gene names  (synonym ):C13orf1 CLLD6

Gene names  (ORF ):

Length:196

Mass:21666

Sequence:MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp