CHM1B_HUMAN   Q7LBR1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7LBR1

Recommended name:Charged multivesicular body protein 1b

EC number:

Alternative names:(CHMP1.5) (Chromatin-modifying protein 1b) (CHMP1b) (Vacuolar protein sorting-associated protein 46-2) (Vps46-2) (hVps46-2)

Cleaved into:

GeneID:57132

Gene names  (primary ):CHMP1B

Gene names  (synonym ):C18orf2

Gene names  (ORF ):

Length:199

Mass:22109

Sequence:MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Tissue specificity:Widely expressed. Expressed in pancreas, kidney, skeletal muscle, liver, lung, placenta and brain. {ECO:0000269|PubMed:11474171}.

Induction:

Developmental stage:

Protein families:SNF7 family


   💬 WhatsApp