CCL14_HUMAN Q16627
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16627
Recommended name：C-C motif chemokine 14
EC number：
Alternative names：(Chemokine CC-1/CC-3) (HCC-1/HCC-3) (HCC-1(1-74)) (NCC-2) (Small-inducible cytokine A14)
Cleaved into：HCC-1(3-74); HCC-1(4-74); HCC-1(9-74)
GeneID：6358
Gene names (primary )：CCL14
Gene names (synonym )：NCC2 SCYA14
Gene names (ORF )：
Length：93
Mass：10678
Sequence：MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Tissue specificity：Expressed constitutively in several normal tissues: spleen, liver, skeletal and heart muscle, gut, and bone marrow, present at high concentrations (1-80 nM) in plasma. {ECO:0000269|PubMed:9600961}.
Induction：
Developmental stage：
Protein families：Intercrine beta (chemokine CC) family