PDC10_HUMAN   Q9BUL8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BUL8

Recommended name:Programmed cell death protein 10

EC number:

Alternative names:(Cerebral cavernous malformations 3 protein) (TF-1 cell apoptosis-related protein 15)

Cleaved into:

GeneID:11235

Gene names  (primary ):PDCD10

Gene names  (synonym ):CCM3 TFAR15

Gene names  (ORF ):

Length:212

Mass:24702

Sequence:MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:15543491}.

Induction:

Developmental stage:

Protein families:PDCD10 family


   💬 WhatsApp