CBLN4_HUMAN   Q9NTU7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NTU7

Recommended name:Cerebellin-4

EC number:

Alternative names:(Cerebellin-like glycoprotein 1)

Cleaved into:

GeneID:140689

Gene names  (primary ):CBLN4

Gene names  (synonym ):CBLNL1

Gene names  (ORF ):UNQ718/PRO1382

Length:201

Mass:21808

Sequence:MGSGRRALSAVPAVLLVLTLPGLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLVGGWQYSTFSGFLVFPL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp