DAND5_HUMAN   Q8N907


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N907

Recommended name:DAN domain family member 5

EC number:

Alternative names:(Cerberus-like protein 2) (Cerl-2) (Cysteine knot superfamily 1, BMP antagonist 3) (Gremlin-3)

Cleaved into:

GeneID:199699

Gene names  (primary ):DAND5

Gene names  (synonym ):CER2 CKTSF1B3 GREM3 SP1

Gene names  (ORF ):

Length:189

Mass:20180

Sequence:MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKARQLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Tissue specificity:

Induction:

Developmental stage:

Protein families:DAN family


   💬 WhatsApp