REC6_HUMAN Q69383
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q69383
Recommended name：Endogenous retrovirus group K member 6 Rec protein
EC number：
Alternative names：(Central open reading frame) (c-orf) (cORF) (Endogenous retrovirus K protein 6) (HERV-K(C7) Rec protein) (HERV-K(HML-2.HOM) Rec protein) (HERV-K108 Rec protein) (HERV-K_7p22.1 provirus Rec protein) (K-Rev) (Rev-like protein) (Rev/Rex homolog)
Cleaved into：
GeneID：
Gene names (primary )：ERVK-6
Gene names (synonym )：ERVK6
Gene names (ORF )：
Length：105
Mass：11828
Sequence：MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETATIENGP
Tissue specificity：Expressed at higher level in placenta, expressed at lower level in several organs and cell lines. {ECO:0000269|PubMed:12083821}.
Induction：
Developmental stage：
Protein families：