CENPW_HUMAN Q5EE01
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5EE01
Recommended name：Centromere protein W
EC number：
Alternative names：(CENP-W) (Cancer-up-regulated gene 2 protein)
Cleaved into：
GeneID：387103
Gene names (primary )：CENPW
Gene names (synonym )：C6orf173 CUG2
Gene names (ORF )：
Length：88
Mass：10061
Sequence：MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAKVILKKSRG
Tissue specificity：Highly expressed in ovary, liver, lung and pancreas and to a lower extent in breast and gastrointestinal tract cancers; such as those of the colon, rectum and stomach. Overexpressed in high grade breast invasive tumors. Expressed in many cancer cell types. {ECO:0000269|PubMed:17079448, ECO:0000269|PubMed:17610844}.
Induction：
Developmental stage：
Protein families：CENP-W/WIP1 family