RET1_HUMAN   P09455


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09455

Recommended name:Retinol-binding protein 1

EC number:

Alternative names:(Cellular retinol-binding protein) (CRBP) (Cellular retinol-binding protein I) (CRBP-I)

Cleaved into:

GeneID:5947

Gene names  (primary ):RBP1

Gene names  (synonym ):CRBP1

Gene names  (ORF ):

Length:135

Mass:15850

Sequence:MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

Tissue specificity:Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver. {ECO:0000269|PubMed:11274389}.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Fatty-acid binding protein (FABP) family


   💬 WhatsApp