RET2_HUMAN   P50120


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P50120

Recommended name:Retinol-binding protein 2

EC number:

Alternative names:(Cellular retinol-binding protein II) (CRBP-II)

Cleaved into:

GeneID:5948

Gene names  (primary ):RBP2

Gene names  (synonym ):CRBP2

Gene names  (ORF ):

Length:134

Mass:15707

Sequence:MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK

Tissue specificity:Higher expression in adult small intestine and to a much lesser extent in fetal kidney. {ECO:0000269|PubMed:11274389}.

Induction:

Developmental stage:

Protein families:Calycin superfamily, Fatty-acid binding protein (FABP) family


   💬 WhatsApp