RABP1_HUMAN   P29762


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P29762

Recommended name:Cellular retinoic acid-binding protein 1

EC number:

Alternative names:(Cellular retinoic acid-binding protein I) (CRABP-I)

Cleaved into:

GeneID:1381

Gene names  (primary ):CRABP1

Gene names  (synonym ):RBP5

Gene names  (ORF ):

Length:137

Mass:15566

Sequence:MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE

Tissue specificity:

Induction:

Developmental stage:

Protein families:Calycin superfamily, Fatty-acid binding protein (FABP) family


   💬 WhatsApp