DJC15_HUMAN   Q9Y5T4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y5T4

Recommended name:DnaJ homolog subfamily C member 15

EC number:

Alternative names:(Cell growth-inhibiting gene 22 protein) (Methylation-controlled J protein) (MCJ)

Cleaved into:

GeneID:29103

Gene names  (primary ):DNAJC15

Gene names  (synonym ):DNAJD1

Gene names  (ORF ):GIG22 HSD18

Length:150

Mass:16383

Sequence:MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH

Tissue specificity:Expressed at highest levels in heart, followed by liver and kidney. {ECO:0000269|PubMed:11358853, ECO:0000269|PubMed:23530063}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp