CIDEC_HUMAN   Q96AQ7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96AQ7

Recommended name:Cell death activator CIDE-3

EC number:

Alternative names:(Cell death-inducing DFFA-like effector protein C) (Fat-specific protein FSP27 homolog)

Cleaved into:

GeneID:63924

Gene names  (primary ):CIDEC

Gene names  (synonym ):FSP27

Gene names  (ORF ):

Length:238

Mass:26754

Sequence:MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ

Tissue specificity:Expressed mainly in adipose tissue, small intestine, heart, colon and stomach and, at lower levels, in brain, kidney and liver. {ECO:0000269|PubMed:12429024, ECO:0000269|PubMed:18334488}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp