CD52_HUMAN P31358
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31358
Recommended name：CAMPATH-1 antigen
EC number：
Alternative names：(CDw52) (Cambridge pathology 1 antigen) (Epididymal secretory protein E5) (Human epididymis-specific protein 5) (He5) (CD antigen CD52)
Cleaved into：
GeneID：1043
Gene names (primary )：CD52
Gene names (synonym )：CDW52 HE5
Gene names (ORF )：
Length：61
Mass：6614
Sequence：MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Tissue specificity：
Induction：
Developmental stage：
Protein families：