CEAM8_HUMAN P31997
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P31997
Recommended name：Carcinoembryonic antigen-related cell adhesion molecule 8
EC number：
Alternative names：(CD67 antigen) (Carcinoembryonic antigen CGM6) (Non-specific cross-reacting antigen NCA-95) (CD antigen CD66b)
Cleaved into：
GeneID：1088
Gene names (primary )：CEACAM8
Gene names (synonym )：CGM6
Gene names (ORF )：
Length：349
Mass：38154
Sequence：MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI
Tissue specificity：Expressed in leukocytes of chronic myeloid Leukemia patients and bone marrow.
Induction：
Developmental stage：
Protein families：Immunoglobulin superfamily, CEA family