MS4A3_HUMAN   Q96HJ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96HJ5

Recommended name:Membrane-spanning 4-domains subfamily A member 3

EC number:

Alternative names:(CD20 antigen-like protein) (Hematopoietic-specific transmembrane protein 4) (HTm4)

Cleaved into:

GeneID:932

Gene names  (primary ):MS4A3

Gene names  (synonym ):CD20L HTM4

Gene names  (ORF ):

Length:214

Mass:22933

Sequence:MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV

Tissue specificity:Expressed specifically in hematopoietic cells and tissues.

Induction:

Developmental stage:

Protein families:MS4A family


   💬 WhatsApp