CCL26_HUMAN   Q9Y258


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y258

Recommended name:C-C motif chemokine 26

EC number:

Alternative names:(CC chemokine IMAC) (Eotaxin-3) (Macrophage inflammatory protein 4-alpha) (MIP-4-alpha) (Small-inducible cytokine A26) (Thymic stroma chemokine-1) (TSC-1)

Cleaved into:

GeneID:10344

Gene names  (primary ):CCL26

Gene names  (synonym ):SCYA26

Gene names  (ORF ):UNQ216/PRO242

Length:94

Mass:10648

Sequence:MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

Tissue specificity:Ubiquitously expressed at low levels in various tissues including heart and ovary. {ECO:0000269|PubMed:10373330, ECO:0000269|PubMed:10488147}.

Induction:

Developmental stage:

Protein families:Intercrine beta (chemokine CC) family


   💬 WhatsApp