CASP6_HUMAN   P55212


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P55212

Recommended name:Caspase-6

EC number:EC:3.4.22.59

Alternative names:(CASP-6) (Apoptotic protease Mch-2)

Cleaved into:Caspase-6 subunit p18; Caspase-6 subunit p11

GeneID:839

Gene names  (primary ):CASP6

Gene names  (synonym ):MCH2

Gene names  (ORF ):

Length:293

Mass:33310

Sequence:MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase C14A family


   💬 WhatsApp