DBND2_HUMAN   Q9BQY9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BQY9

Recommended name:Dysbindin domain-containing protein 2

EC number:

Alternative names:(Casein kinase-1 binding protein) (CK1BP) (HSMNP1)

Cleaved into:

GeneID:55861

Gene names  (primary ):DBNDD2

Gene names  (synonym ):C20orf35

Gene names  (ORF ):

Length:259

Mass:27671

Sequence:MGAGNFLTALEVPVAALAGAASDRRASCERVSPPPPLPHFRLPPLPRSRLPGPVSRPEPGAPLLGCWLQWGAPSPGPLCLLFRLCSCTCFAPLPAGADMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS

Tissue specificity:Detected in brain. {ECO:0000269|PubMed:16618118}.

Induction:

Developmental stage:

Protein families:Dysbindin family


   💬 WhatsApp