HPLN1_HUMAN P10915
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10915
Recommended name:Hyaluronan and proteoglycan link protein 1
EC number:
Alternative names:(Cartilage-linking protein 1) (Cartilage-link protein) (Proteoglycan link protein)
Cleaved into:
GeneID:1404
Gene names (primary ):HAPLN1
Gene names (synonym ):CRTL1
Gene names (ORF ):
Length:354
Mass:40166
Sequence:MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Tissue specificity:Widely expressed. Weakly expressed in the brain. {ECO:0000269|PubMed:11027579, ECO:0000269|PubMed:12663660}.
Induction:
Developmental stage:
Protein families:HAPLN family