NKX25_HUMAN   P52952


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52952

Recommended name:Homeobox protein Nkx-2.5

EC number:

Alternative names:(Cardiac-specific homeobox) (Homeobox protein CSX) (Homeobox protein NK-2 homolog E)

Cleaved into:

GeneID:1482

Gene names  (primary ):NKX2-5

Gene names  (synonym ):CSX NKX2.5 NKX2E

Gene names  (ORF ):

Length:324

Mass:34918

Sequence:MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW

Tissue specificity:Expressed only in the heart.

Induction:

Developmental stage:

Protein families:NK-2 homeobox family


   💬 WhatsApp