NKX25_HUMAN P52952
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52952
Recommended name：Homeobox protein Nkx-2.5
EC number：
Alternative names：(Cardiac-specific homeobox) (Homeobox protein CSX) (Homeobox protein NK-2 homolog E)
Cleaved into：
GeneID：1482
Gene names (primary )：NKX2-5
Gene names (synonym )：CSX NKX2.5 NKX2E
Gene names (ORF )：
Length：324
Mass：34918
Sequence：MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW
Tissue specificity：Expressed only in the heart.
Induction：
Developmental stage：
Protein families：NK-2 homeobox family