CEAM7_HUMAN Q14002
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14002
Recommended name:Carcinoembryonic antigen-related cell adhesion molecule 7
EC number:
Alternative names:(Carcinoembryonic antigen CGM2)
Cleaved into:
GeneID:1087
Gene names (primary ):CEACAM7
Gene names (synonym ):CGM2
Gene names (ORF ):
Length:265
Mass:29379
Sequence:MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI
Tissue specificity:Expressed in columnar epithelial cells of the colon (at protein level) (PubMed:10436421). Strongly down-regulated in colonic adenocarcinomas. {ECO:0000269|PubMed:10436421}.
Induction:
Developmental stage:
Protein families:Immunoglobulin superfamily, CEA family