CAZA3_HUMAN   Q96KX2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q96KX2

Recommended name:F-actin-capping protein subunit alpha-3

EC number:

Alternative names:(CapZ alpha-3) (CP-alpha-3) (Germ cell-specific protein 3)

Cleaved into:

GeneID:93661

Gene names  (primary ):CAPZA3

Gene names  (synonym ):CAPAA3 GSG3

Gene names  (ORF ):

Length:299

Mass:35025

Sequence:MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQNQLKDIQSHGIIQNEAEYLRVVLLCALKLYVNDHYPKGNCNMLRKTVKSKEYLIACIEDHNYETGECWNGLWKSKWIFQVNPFLTQVTGRIFVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII

Tissue specificity:Expressed exclusively in testis and sperm. Highest expression is found in the neck region of ejaculated sperm with lower levels found in the tail and postacrosome region. {ECO:0000269|PubMed:12029070}.

Induction:

Developmental stage:

Protein families:F-actin-capping protein alpha subunit family


   💬 WhatsApp