DEC1_HUMAN   Q9P2X7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P2X7

Recommended name:Deleted in esophageal cancer 1

EC number:

Alternative names:(Candidate tumor suppressor CTS9)

Cleaved into:

GeneID:

Gene names  (primary ):DELEC1

Gene names  (synonym ):CTS9 DEC1

Gene names  (ORF ):

Length:70

Mass:7542

Sequence:MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD

Tissue specificity:Expressed in many tissues, with highest expression in prostate and testis. Reduced expression in esophageal carcinomas. {ECO:0000269|PubMed:10612805}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp